DPCfam | MC254074
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 119 ± 15 aa |
| Residues in low-complexity regions (%) | 3.29 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 32.32 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF09611 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 34.61 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0W0WL18 | 147-272 | 126 | LRKGFLSIKKNTTTAITSECVKQVYFPVASGYHLLSILTPSGLVYELRNRIQSIRFSDEIKEARDNKRKNLYNEKGFDELYGLAM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6D0W8-F1 | 179-295 | 98.32 | 92.06 | View in AlphaFoldDB ↗ |