DPCfam | MC253757
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 142 ± 20 aa |
| Residues in low-complexity regions (%) | 1.92 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.2 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02192 |
| Sequences matching dominant architecture (%) | 90.38 |
| Average overlap percent | 53.34 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| B7QJF5 | 1-82 | 82 | VDCLMPTGIIIPLDCARDATLESIKDNLWDIAQKYPLFNRLGDPSSYIFVSITRDAEKEEFYDESRRLCDLHLFHPLLKIIY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D4A5Q1-F1 | 19-159 | 98.60 | 92.50 | View in AlphaFoldDB ↗ |