DPCfam | MC253634
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 216 ± 36 aa |
| Residues in low-complexity regions (%) | 5.05 |
| Residues in coiled-coil regions (%) | 0.32 |
| Predicted disordered residues (%) | 18.66 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q173I8 | 630-782 | 153 | WDTVTIEENDERNQPVQSTIHIPALPSFPLQKLLHVITTLLNTLVPQTIPKAIVLQVVERIISYLHDHYRFLSQNDFIQKNQNCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LCR1-F1 | 705-946 | 98.64 | 73.39 | View in AlphaFoldDB ↗ |