DPCfam | MC253632
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Residues in low-complexity regions (%) | 4.62 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 22.95 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10070 |
| Sequences matching dominant architecture (%) | 99.36 |
| Average overlap percent | 23.92 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7ZXY4 | 26-209 | 184 | WPMRAFIHHNPLHGLERMPFEEAVAEGKQLFHGAGFLPRTTYQHYYKQNKIDRQLLSAGIDGFLEEHESISGIDLHSWLLNLLIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5ERS0-F1 | 12-165 | 99.39 | 92.84 | View in AlphaFoldDB ↗ |