DPCfam | MC253617
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 571 |
|---|---|
| Mean domain length (aa) | 116 ± 13 aa |
| Residues in low-complexity regions (%) | 9.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 2.34 |
| Average transmembrane regions | 2.96 |
| Dominant Pfam architecture(s) | PF01566 |
| Sequences matching dominant architecture (%) | 99.01 |
| Average overlap percent | 42.86 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q8RBX2 | 283-420 | 138 | MLKPLLGNASAVVFALALLFAGISSSITAGMAGGSIFAGIYGEPYDIHDAHTKVGVGITYIFAVLIIFFVKSPFQGLVYSQMFLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A3Q0KJR2-F1 | 252-370 | 98.35 | 88.78 | View in AlphaFoldDB ↗ |