DPCfam | MC253600
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 299 ± 43 aa |
| Residues in low-complexity regions (%) | 16.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11540 |
| Sequences matching dominant architecture (%) | 23.4 |
| Average overlap percent | 9.78 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1A8R3U8 | 1-328 | 328 | MSDKSDLKAELERKKQRLAQIREEKKKREEERKKKEKSDSQQKTEVPPVDSDLDRKRRETEALLQSIGISPEPPLVPTPVSPSKS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q24246-F1 | 2-334 | 99.30 | 58.26 | View in AlphaFoldDB ↗ |