DPCfam | MC253470
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Residues in low-complexity regions (%) | 4.05 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4Z2V0 | 17-96 | 80 | GAMARNCTPGLNYCGSTLLDIGHYQSQIDQAIADAGVPEVDNGRESLFHCIGGDNGVIKYLGDCPNGCHDAGAGNSDYCV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WH84-F1 | 10-101 | 96.84 | 85.67 | View in AlphaFoldDB ↗ |