DPCfam | MC253446
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 313 ± 38 aa |
| Residues in low-complexity regions (%) | 3.96 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 15.18 |
| Average transmembrane regions | 0.3 |
| Dominant Pfam architecture(s) | PF14838 |
| Sequences matching dominant architecture (%) | 91.04 |
| Average overlap percent | 56.34 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| V3YZW7 | 601-946 | 346 | DELKNVRHCKQCIKQLTKHSFTQCMLVRFLMEGAVNQEYSYLLGARPSPETKPSTAEMTSLLQENRLHGTSLTLSRSHSSVFHAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R4IY96-F1 | 678-1021 | 99.36 | 79.00 | View in AlphaFoldDB ↗ |