DPCfam | MC253341
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 481 |
|---|---|
| Mean domain length (aa) | 559 ± 67 aa |
| Residues in low-complexity regions (%) | 2.63 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 20.54 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF05947 |
| Sequences matching dominant architecture (%) | 99.18 |
| Average overlap percent | 98.0 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C5W4I1 | 7-584 | 578 | DTLKQYFLREMEYLRKESVRFAREYPQVAQELALNQERSDDPQVELLLQSFAYLSGQLRYQMAMDDAELPNQLLAALNPHLEIPW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I744-F1 | 6-609 | 100.00 | 88.47 | View in AlphaFoldDB ↗ |