DPCfam | MC252447
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 165 ± 35 aa |
| Residues in low-complexity regions (%) | 1.85 |
| Residues in coiled-coil regions (%) | 0.18 |
| Predicted disordered residues (%) | 16.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008F9D776 | 28-204 | 177 | AQNLLNLPRTFSRQSARFELPLDTSTLERMTPLEYINQHVIVTRDRRLFYNLVFECNEQNVEMTRKDALHLTKRYMDTQRIKPAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9VUR8-F1 | 387-559 | 99.36 | 81.55 | View in AlphaFoldDB ↗ |