DPCfam | MC252018
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Residues in low-complexity regions (%) | 3.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.54 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF03104 |
| Sequences matching dominant architecture (%) | 97.33 |
| Average overlap percent | 55.3 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7W5B3 | 310-499 | 190 | LLGTNNSALELFLIKRKIKGPSWLSISKFVACPSTQRVSWCKFEVTVDSPKDISVLMTSNTLEVPPVVVAAVNLKTIINEKHNVH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E7FB68-F1 | 519-680 | 99.39 | 92.27 | View in AlphaFoldDB ↗ |