DPCfam | MC251993
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 221 |
|---|---|
| Mean domain length (aa) | 169 ± 30 aa |
| Residues in low-complexity regions (%) | 3.96 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 11.87 |
| Average transmembrane regions | 0.21 |
| Dominant Pfam architecture(s) | PF05282 |
| Sequences matching dominant architecture (%) | 97.1 |
| Average overlap percent | 51.29 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| X6NM30 | 299-441 | 143 | ASQLTKLHMDRTPILKYVLEKLTDESELLAEMQYSFVCFLIGRTLSGLEQWKRIVDLLCNCEEGVELYKDLYLKFIRIISIQLKE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-F1R8D9-F1 | 208-376 | 100.00 | 90.21 | View in AlphaFoldDB ↗ |