DPCfam | MC251741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 484 ± 48 aa |
| Residues in low-complexity regions (%) | 20.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 75.97 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF15402 |
| Sequences matching dominant architecture (%) | 36.76 |
| Average overlap percent | 65.7 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A1TFV8 | 50-526 | 477 | KSRSKSVGPGGFDTLRQSAGNRRASLAAPRSILKPRLSDAPSPQRHKRQSDVYRRSDGRENRTQTLDEPTISKIALRTEEEQQAA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W8I8-F1 | 47-566 | 99.38 | 37.83 | View in AlphaFoldDB ↗ |