DPCfam | MC251728
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 142 ± 21 aa |
| Residues in low-complexity regions (%) | 10.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 54.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF11881 |
| Sequences matching dominant architecture (%) | 93.48 |
| Average overlap percent | 62.64 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| H2ULQ5 | 1567-1684 | 118 | RRSLQRTLSDESIYGGQREPSSGGQCDLSTDLFSCSTMPRSPTNRHGPSRRASHKSLGKYPSNSGDLSSQERSEKDLEKLKQQLE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5JCS6-F1 | 1449-1588 | 96.15 | 36.12 | View in AlphaFoldDB ↗ |