DPCfam | MC251711
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1261 |
|---|---|
| Mean domain length (aa) | 63 ± 8 aa |
| Residues in low-complexity regions (%) | 1.15 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 25.17 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01805 |
| Sequences matching dominant architecture (%) | 96.8 |
| Average overlap percent | 77.56 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061R0M3 | 14-72 | 59 | HRPADPGLIQRIQKLVEFVLRNGAQFEELMRQKQQGNPEYDFLFGGDGAPYYRWTLYCA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9FG18-F1 | 394-455 | 95.38 | 78.33 | View in AlphaFoldDB ↗ |