DPCfam | MC251615
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1061 |
|---|---|
| Mean domain length (aa) | 89 ± 9 aa |
| Residues in low-complexity regions (%) | 1.42 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.34 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03045 |
| Sequences matching dominant architecture (%) | 37.43 |
| Average overlap percent | 91.18 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1L8GJC1 | 3464-3551 | 88 | CLVHKDSKLITHGTCESEQTVEMAYCEGSCSTKSIYSADSNSMEHTCSCCQEMKTSQRQIDLKCKDGSKSVFSYTYVEECGCSRT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O73755-F1 | 87-180 | 95.74 | 91.58 | View in AlphaFoldDB ↗ |