DPCfam | MC251444
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Residues in low-complexity regions (%) | 0.56 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13180 |
| Sequences matching dominant architecture (%) | 40.0 |
| Average overlap percent | 57.57 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D1ZLC2 | 259-322 | 64 | GIQIQLMESENIRHSLGMTPEQSGILVNKVYPLSDALGNLQKDDIITSIDGYPIGNDGTIPFRD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9SHZ0-F1 | 284-342 | 100.00 | 96.04 | View in AlphaFoldDB ↗ |