DPCfam | MC251286
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 265 ± 55 aa |
| Residues in low-complexity regions (%) | 6.42 |
| Residues in coiled-coil regions (%) | 2.34 |
| Predicted disordered residues (%) | 3.06 |
| Average transmembrane regions | 6.46 |
| Dominant Pfam architecture(s) | PF09815 |
| Sequences matching dominant architecture (%) | 91.28 |
| Average overlap percent | 85.51 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q16KK2 | 112-412 | 301 | VVPGIVTSTLTVYMYLEDMKEHKKVRKRCCEILIFIIIVPLFFRYCQSLAYAIQSKIAEARNDRDAQKKYYEFMIQEDSDVALVR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5GH64-F1 | 101-442 | 99.65 | 80.06 | View in AlphaFoldDB ↗ |