DPCfam | MC250961
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 97 ± 14 aa |
| Residues in low-complexity regions (%) | 4.39 |
| Residues in coiled-coil regions (%) | 0.13 |
| Predicted disordered residues (%) | 17.64 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF12432 |
| Sequences matching dominant architecture (%) | 0.91 |
| Average overlap percent | 2.13 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A158PKX5 | 674-771 | 98 | GVDEENSKLIGTVCFNQPRELPRRPPEQFIRKLETLAVDCSMASRLCECRQPDMVDQLVRNVGPSKAMPAIQELFTMNASAIEAM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9W1C5-F1 | 792-887 | 98.97 | 80.36 | View in AlphaFoldDB ↗ |