DPCfam | MC250945
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 88 ± 16 aa |
| Residues in low-complexity regions (%) | 1.55 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 31.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01055 |
| Sequences matching dominant architecture (%) | 1.59 |
| Average overlap percent | 2.17 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B8G9V9 | 1-90 | 90 | MKFRDGMWLVAEGTTIEYAEQVYSITERADKKALSLLCPTRRISNRGDVLNRSTLTIDIEAVSDGIISVESTHWAGAVRKGPNFE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5AW25-F1 | 1-86 | 97.75 | 95.56 | View in AlphaFoldDB ↗ |