DPCfam | MC250866
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 99 ± 14 aa |
| Residues in low-complexity regions (%) | 2.58 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07910 |
| Sequences matching dominant architecture (%) | 99.28 |
| Average overlap percent | 39.45 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A9S8I2 | 283-391 | 109 | SATSAFDRLRQPIVFSKRSPLYFQHRGHSRTIVGIEKRWRPGVSEEVYLIVLDPSQKTGDVIRALRDKSGWQRLLKRGIQTLKHA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0VDR8-F1 | 373-474 | 92.93 | 88.62 | View in AlphaFoldDB ↗ |