DPCfam | MC250272
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 2771 |
|---|---|
| Mean domain length (aa) | 288 ± 27 aa |
| Residues in low-complexity regions (%) | 2.76 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 16.67 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF01368- PF02272 |
| Sequences matching dominant architecture (%) | 66.9 |
| Average overlap percent | 95.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A117S5D5 | 6-300 | 295 | VKQAIINSSELVIVSHEYPDGDSIGSSIALSKGLLKLGKVVKTIIDSDVPRDYQFLAGAKDFRKPKDIEVHSDSTVIFLDCADET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FXM3-F1 | 12-296 | 98.36 | 96.61 | View in AlphaFoldDB ↗ |