DPCfam | MC250101
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 541 |
|---|---|
| Mean domain length (aa) | 59 ± 6 aa |
| Residues in low-complexity regions (%) | 10.86 |
| Residues in coiled-coil regions (%) | 0.04 |
| Predicted disordered residues (%) | 1.37 |
| Average transmembrane regions | 1.88 |
| Dominant Pfam architecture(s) | PF06808 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 16.2 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0LPA4 | 196-266 | 71 | RNYPVSSERFSIRKVFECFRGALLGITAMAIILGGILTGIFTPTEAGAAATAYVLIVGAFFTRKLKFSSII... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O07838-F1 | 219-279 | 100.00 | 93.43 | View in AlphaFoldDB ↗ |