DPCfam | MC250096
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 91 ± 11 aa |
| Residues in low-complexity regions (%) | 0.57 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.67 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF05919 |
| Sequences matching dominant architecture (%) | 98.23 |
| Average overlap percent | 36.93 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A5YRF7 | 399-506 | 108 | ELMYSVGQPMGALSSWGMLALTHHTIVQVAASRAGYKDLFLDYALLGDDICIANKAVADNYLLIMRDLGVEINLSKSLISSTGVV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q3EC48-F1 | 91-185 | 97.89 | 92.38 | View in AlphaFoldDB ↗ |