DPCfam | MC250019
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 202 ± 18 aa |
| Residues in low-complexity regions (%) | 3.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 21.79 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1X0CJH8 | 38-249 | 212 | AAFLSTEHQQELLDGPGQAAWDVDLPSQSFVFHSDPPTTLSCDFLGSASPEAGSWLWGWENVNGFPDGVIALAGTIRDYGEANGI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EP19-F1 | 17-233 | 100.00 | 96.89 | View in AlphaFoldDB ↗ |