DPCfam | MC249862
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3441 |
|---|---|
| Mean domain length (aa) | 113 ± 10 aa |
| Residues in low-complexity regions (%) | 7.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.67 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01225- PF08245 |
| Sequences matching dominant architecture (%) | 81.34 |
| Average overlap percent | 38.58 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000262CD30 | 18-120 | 103 | KGNPVISGLAIDSRKVTEGDLFVALVAERDGHDFIENAAESGASAALVSKPITTLPSIFVKDTEVAMSDLARAIRDSFAGEVLAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P96613-F1 | 25-130 | 93.68 | 95.38 | View in AlphaFoldDB ↗ |