DPCfam | MC249792
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 491 |
|---|---|
| Mean domain length (aa) | 178 ± 26 aa |
| Residues in low-complexity regions (%) | 3.05 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 21.78 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF06041 |
| Sequences matching dominant architecture (%) | 99.52 |
| Average overlap percent | 93.78 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G1XEH0 | 69-253 | 185 | ISPSNFPIKGLTDAEIAAPFVAEIEAAEGSGDAEAKTKTALSFMILLDQIPRNLYRTKETLPLVYTHYDPIAISLARHITSMPIG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GSF5-F1 | 27-218 | 98.38 | 94.34 | View in AlphaFoldDB ↗ |