DPCfam | MC249587
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 301 |
|---|---|
| Mean domain length (aa) | 107 ± 10 aa |
| Residues in low-complexity regions (%) | 2.57 |
| Residues in coiled-coil regions (%) | 0.07 |
| Predicted disordered residues (%) | 11.17 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF08771 |
| Sequences matching dominant architecture (%) | 88.93 |
| Average overlap percent | 16.33 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I8BSJ7 | 2112-2226 | 115 | LEVVPQLIARLDSQNNTGLLVRQLVIDVAKAYPQAWVYALTAAIKSRNTRRSQVAKEILDIVAENKPLLVEQATLVNDELIRCAI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175WB37-F1 | 1799-1903 | 99.05 | 80.95 | View in AlphaFoldDB ↗ |