DPCfam | MC24954
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 82 ± 7 aa |
| Residues in low-complexity regions (%) | 4.01 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.64 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008308C0C | 208-302 | 95 | ISFGWWPGDPATPEPTFYSYTHPEPDTLTQQPLRPPTARWAPTGMTHQARLPWADALASPQPRDAVLDFLQSAYAAGAKTADWPY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F957-F1 | 218-302 | 98.81 | 96.82 | View in AlphaFoldDB ↗ |