DPCfam | MC249411
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 321 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Residues in low-complexity regions (%) | 0.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.33 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF09133 |
| Sequences matching dominant architecture (%) | 97.03 |
| Average overlap percent | 85.82 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0E0FML1 | 26-122 | 97 | QACVELDDWWLERVEGEEGKVRVVGSNTTTSRAGRRFTSASIKTRHASGDLETEDGIIIMIARPPNISKMHLNGFPDEVSKHFSL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0I9N4B1-F1 | 41-140 | 97.87 | 82.84 | View in AlphaFoldDB ↗ |