DPCfam | MC24938
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 641 |
|---|---|
| Mean domain length (aa) | 226 ± 49 aa |
| Residues in low-complexity regions (%) | 4.34 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.96 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00926 |
| Sequences matching dominant architecture (%) | 51.9 |
| Average overlap percent | 94.89 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q1AZ21 | 6-261 | 256 | VEEIIEEIRAGRMVIVCDDEDRENEGDLTVAAELVTPEHINFMAKYGRGLICLPMAQELIERLEIPEMVRHNSSRMGTAFTVSIE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O66679-F1 | 12-264 | 100.00 | 95.25 | View in AlphaFoldDB ↗ |