DPCfam | MC2493
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Residues in low-complexity regions (%) | 0.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.98 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| G9P2H6 | 1-57 | 57 | MPTYLCHGFRWTRRLIRIFVILEDLEDAAPDWIVGRDTSAIILERMNTKFDYLPQRL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W9X5-F1 | 1-54 | 98.18 | 91.94 | View in AlphaFoldDB ↗ |