DPCfam | MC249232
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Residues in low-complexity regions (%) | 7.29 |
| Residues in coiled-coil regions (%) | 20.11 |
| Predicted disordered residues (%) | 41.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14357 |
| Sequences matching dominant architecture (%) | 97.87 |
| Average overlap percent | 91.74 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1F9YHX3 | 5-111 | 106 | TVAKIQRAVRTAGQMDPKHKAELVVLLEKLEAEIRALPSSQAEKAHSIAQFAEAATNEAARRDKSAKLLMLSRGALQESVADFET... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I038-F1 | 3-87 | 98.85 | 86.17 | View in AlphaFoldDB ↗ |