DPCfam | MC249219
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 441 |
|---|---|
| Mean domain length (aa) | 248 ± 40 aa |
| Residues in low-complexity regions (%) | 2.88 |
| Residues in coiled-coil regions (%) | 0.09 |
| Predicted disordered residues (%) | 25.22 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF01803 |
| Sequences matching dominant architecture (%) | 87.99 |
| Average overlap percent | 90.03 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0H5CA59 | 343-591 | 249 | SNVEVLKVLDFCELVGVRSESTKNILYWKKIITEYFSEVGVLRYSVKSGVDHRQFEFSVPIIPRFFFSIIQSGVLRIEIQPGMLR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C0NCX3-F1 | 366-599 | 98.72 | 88.39 | View in AlphaFoldDB ↗ |