DPCfam | MC249163
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 287 ± 35 aa |
| Residues in low-complexity regions (%) | 14.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.74 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V5QJT1 | 100-418 | 319 | DAVHIVFGKLGQIVVEDMRNTGNVETTSGHISRHQNAGTPQAHIVDGAIAGTLLHVAMQRGGGKTGDQQLVGDQVGIALGGGKHQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0P0YBY8-F1 | 2-112 | 36.72 | 28.47 | View in AlphaFoldDB ↗ |