DPCfam | MC249057
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 115 ± 19 aa |
| Residues in low-complexity regions (%) | 1.37 |
| Residues in coiled-coil regions (%) | 7.99 |
| Predicted disordered residues (%) | 20.69 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00580 |
| Sequences matching dominant architecture (%) | 1.79 |
| Average overlap percent | 20.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V4JRZ3 | 1174-1299 | 126 | MEERRDSMLETAKLCFTSASRCEGDGDEEEWLIHYMLGKIAEKQKQPPVVYLLHYKQAAHYLHEEAARYPKKIHYHNPPELAMEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9Y6J0-F1 | 1183-1300 | 100.00 | 86.05 | View in AlphaFoldDB ↗ |