DPCfam | MC249048
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 62 ± 7 aa |
| Residues in low-complexity regions (%) | 0.36 |
| Residues in coiled-coil regions (%) | 1.19 |
| Predicted disordered residues (%) | 12.0 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04439 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 27.31 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061NUN4 | 226-284 | 59 | WEQYKKTYASANLEASWDALFTACQLFKALAQDVAAIHQFSFLEEEHQKMLMYLNELNE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9EZC0-F1 | 222-279 | 90.77 | 97.39 | View in AlphaFoldDB ↗ |