DPCfam | MC24903
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Residues in low-complexity regions (%) | 0.14 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.83 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00679 |
| Sequences matching dominant architecture (%) | 94.9 |
| Average overlap percent | 36.31 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| O13869 | 424-497 | 74 | YRIKYKNGREEVISNPNLFPTNHQGISELLEPTVDATIITPSEYLGDVIKLCESCRGLQKDCTYMSESRCMIKY... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5KWZ3-F1 | 381-448 | 100.00 | 89.67 | View in AlphaFoldDB ↗ |