DPCfam | MC248801
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 281 |
|---|---|
| Mean domain length (aa) | 445 ± 88 aa |
| Residues in low-complexity regions (%) | 2.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.75 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF08064 |
| Sequences matching dominant architecture (%) | 95.45 |
| Average overlap percent | 21.4 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A146VMU2 | 1-384 | 384 | MADYLQPKLLGILAFFNMQLLSSSAGEKDRKKMALTSVVALMRLMGSKHISSVRVKMMTTLRTGLRYREDFPLLCCQTWECFVRS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9JKK8-F1 | 1029-1465 | 99.54 | 75.53 | View in AlphaFoldDB ↗ |