DPCfam | MC248682
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 64 ± 7 aa |
| Residues in low-complexity regions (%) | 8.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.48 |
| Average transmembrane regions | 0.89 |
| Dominant Pfam architecture(s) | PF07690 |
| Sequences matching dominant architecture (%) | 70.0 |
| Average overlap percent | 31.27 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K9G0R5 | 847-916 | 70 | IISAVSMLVASSLAKRIGNVKTMVFTHLPSAICLALISVPSSLPLALTFLVLRACSQNMDVAPRSAFLAV... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CUG7-F1 | 43-103 | 100.00 | 90.99 | View in AlphaFoldDB ↗ |