DPCfam | MC248628
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Residues in low-complexity regions (%) | 2.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.38 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF05918 |
| Sequences matching dominant architecture (%) | 91.61 |
| Average overlap percent | 47.46 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A151ZFM9 | 37-162 | 126 | ELYNEILSLSQRSNQTKRLTPQFVSKFFKRFPTVQEKSVDCIIDLFESEEVAVRIGAIKSVSDICQQDPKLISRMVDILSQILNT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B1WC49-F1 | 24-151 | 99.24 | 96.35 | View in AlphaFoldDB ↗ |