DPCfam | MC248478
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 103 ± 10 aa |
| Residues in low-complexity regions (%) | 12.74 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 3.22 |
| Average transmembrane regions | 1.96 |
| Dominant Pfam architecture(s) | PF13038 |
| Sequences matching dominant architecture (%) | 98.44 |
| Average overlap percent | 76.54 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0U1QQE0 | 20-125 | 106 | ILISIVVQGLSDRSFSLITLINHLSVVSLLSLNLGLIIFIIQGGFFDGMTYSFKRVARAFRKKQLGEQEAEAPLAEMKHREGSQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2FZR8-F1 | 14-121 | 95.41 | 88.71 | View in AlphaFoldDB ↗ |