DPCfam | MC24839
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Residues in low-complexity regions (%) | 4.81 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.48 |
| Average transmembrane regions | 0.07 |
| Dominant Pfam architecture(s) | PF03853- PF01256 |
| Sequences matching dominant architecture (%) | 80.17 |
| Average overlap percent | 18.9 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E3DPK6 | 207-282 | 76 | PGKDYAGKIKVVEIGIQSETIQENSDQLKVFNQQEAKKSLPVRKNNSHKGSFGKLALLAGSPGMTGAPILTAKAAL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B5YIM0-F1 | 185-269 | 100.00 | 96.38 | View in AlphaFoldDB ↗ |