DPCfam | MC248051
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 208 ± 17 aa |
| Residues in low-complexity regions (%) | 0.41 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E0VNJ5 | 201-410 | 210 | ESPNLTNNSWRDLFPVIKLDVSSGRLVFGNRLIPTTLSVNVEEAHFVYSIKPAASKLDYFMHILKCVAENFKVILAPSPKYTGMI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A077ZPV1-F1 | 209-360 | 80.10 | 80.52 | View in AlphaFoldDB ↗ |