DPCfam | MC247878
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 163 ± 31 aa |
| Residues in low-complexity regions (%) | 5.25 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 37.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF03619 |
| Sequences matching dominant architecture (%) | 23.73 |
| Average overlap percent | 4.71 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| J3NNA9 | 290-426 | 137 | ARMPVKYALRDAFGIRDLIEDSKETFKGDKYGYRAFDSGDRIMAHESSTSRLARVRAGMRYERGGKGKYWIPKPGQITSDINPYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GQ03-F1 | 275-420 | 97.62 | 66.34 | View in AlphaFoldDB ↗ |