DPCfam | MC247871
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 157 ± 10 aa |
| Residues in low-complexity regions (%) | 6.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 30.22 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF10131 |
| Sequences matching dominant architecture (%) | 1.75 |
| Average overlap percent | 0.43 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006D27EB0 | 1-129 | 128 | MDTPWGSCPPTLGRSDRDSHRARLGWAGSLAGGYFVGPTSRDKKGIYGPEFLPTMALLVRVHDTGVIPPIGQDERAEAIADLNSW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EQS8-F1 | 466-622 | 99.37 | 95.92 | View in AlphaFoldDB ↗ |