DPCfam | MC247831
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 351 |
|---|---|
| Mean domain length (aa) | 251 ± 37 aa |
| Residues in low-complexity regions (%) | 6.67 |
| Residues in coiled-coil regions (%) | 0.24 |
| Predicted disordered residues (%) | 3.56 |
| Average transmembrane regions | 4.93 |
| Dominant Pfam architecture(s) | PF06459 |
| Sequences matching dominant architecture (%) | 0.32 |
| Average overlap percent | 4.3 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| T1FJQ6 | 1899-2109 | 210 | MCLTLFITSLISFVVPVYIGRRLMSFWMGDSRIHELYTAALGLYVCWLALRVGGVVFKWVPQGTKFMVRKILEWIVVNWAVGVVQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5R9W1-F1 | 647-892 | 98.80 | 87.53 | View in AlphaFoldDB ↗ |