DPCfam | MC24752
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 451 |
|---|---|
| Mean domain length (aa) | 107 ± 19 aa |
| Residues in low-complexity regions (%) | 10.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 57.42 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09532 |
| Sequences matching dominant architecture (%) | 73.35 |
| Average overlap percent | 88.73 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S7LTQ6 | 235-335 | 101 | NIPSPILKFDTDFDFASSNAQFIKDELEREVQEKRNLKDEGMKKAKARMHTLLEYEDIGPECYYDKAKSFFDNASSDNGLGFRLT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0EBP1-F1 | 185-297 | 97.27 | 67.09 | View in AlphaFoldDB ↗ |