DPCfam | MC24722
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 571 |
|---|---|
| Mean domain length (aa) | 79 ± 11 aa |
| Residues in low-complexity regions (%) | 2.91 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.29 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13621 |
| Sequences matching dominant architecture (%) | 99.04 |
| Average overlap percent | 35.91 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A061DXA2 | 127-221 | 95 | YSPFVDAAPQQMYLAQVPIINAENEDRVQLETLREDIQMPAILEEKNLSSVNLWMNNAQARSSAHYDPHNNLLCIVTGRKQVVLW... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2HI47-F1 | 281-393 | 97.26 | 80.49 | View in AlphaFoldDB ↗ |