DPCfam | MC247183
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 141 |
|---|---|
| Mean domain length (aa) | 70 ± 9 aa |
| Residues in low-complexity regions (%) | 7.16 |
| Residues in coiled-coil regions (%) | 0.46 |
| Predicted disordered residues (%) | 6.29 |
| Average transmembrane regions | 1.78 |
| Dominant Pfam architecture(s) | PF05360 |
| Sequences matching dominant architecture (%) | 83.04 |
| Average overlap percent | 74.29 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0M8YCE8 | 8-88 | 81 | PTTNAFYAQAVISFVVSLAAVGLGVAYLPVDGWVRAFLALGLLFTVTSAFTLAKCVRDRQEETYVVSRVDQARLEKLLAEH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P0ADJ8-F1 | 8-72 | 90.28 | 93.12 | View in AlphaFoldDB ↗ |